PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj6g3v1584620.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NF-YB
Protein Properties Length: 120aa    MW: 13135.2 Da    PI: 5.9231
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj6g3v1584620.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB143.83.9e-451781794
            NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
                     mkk lPan+ki+kdaketvqecvsefisfvtseasdkcqrekrktingddllwa+atlGfe+y++plk+yl+ yre +
  Lj6g3v1584620.1  1 MKKGLPANGKIAKDAKETVQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFEEYIDPLKLYLAAYREGD 78
                     9**************************************************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.3E-40185IPR009072Histone-fold
SuperFamilySSF471132.51E-30184IPR009072Histone-fold
PfamPF008083.3E-21155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.1E-201937No hitNo description
PROSITE patternPS0068502238IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.1E-203856No hitNo description
PRINTSPR006153.1E-205775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 120 aa     Download sequence    Send to blast
MKKGLPANGK IAKDAKETVQ ECVSEFISFV TSEASDKCQR EKRKTINGDD LLWAMATLGF  60
EEYIDPLKLY LAAYREGDSK GSAKGGDASA ASDVEMFCCG IDSLLIKVLT HKLLITLILR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A2e-371761893NF-YB
4awl_B2e-371761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-371761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.224951e-138root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003537251.14e-57PREDICTED: nuclear transcription factor Y subunit B-10-like
RefseqXP_007027238.12e-56Nuclear transcription factor Y subunit B-10 isoform 3
RefseqXP_010107598.12e-56Nuclear transcription factor Y subunit B-8
SwissprotQ67XJ21e-54NFYBA_ARATH; Nuclear transcription factor Y subunit B-10
TrEMBLK7LHH35e-59K7LHH3_SOYBN; Uncharacterized protein
STRINGGLYMA10G05606.12e-58(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25453382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.18e-49nuclear factor Y, subunit B10